PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 300aa    MW: 32639.1 Da    PI: 9.6323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-5951PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-19550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
        Vun007952  5 KGPWSPEEDDALQKLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 50
                     79******************************.***********985 PP

2Myb_DNA-binding56.37.5e-1859101347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +v+a++++G++ W+tIar ++ gRt++ +k++w++ 
        Vun007952  59 AFTPEEDDTIVRAHARFGNK-WATIARLLQ-GRTDNAIKNHWNST 101
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.748155IPR017930Myb domain
SuperFamilySSF466892.7E-32298IPR009057Homeodomain-like
SMARTSM007171.1E-17453IPR001005SANT/Myb domain
PfamPF002492.5E-19550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-26658IPR009057Homeodomain-like
CDDcd001674.94E-17749No hitNo description
SMARTSM007172.6E-1456104IPR001005SANT/Myb domain
PROSITE profilePS5129421.24157106IPR017930Myb domain
PfamPF002492.6E-1559101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2359105IPR009057Homeodomain-like
CDDcd001671.05E-1159102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDRIKGPWSP EEDDALQKLV EKHGPRNWSL ISKSIPGRSG KSCRLRWCNQ LSPQVEHRAF  60
TPEEDDTIVR AHARFGNKWA TIARLLQGRT DNAIKNHWNS TLKRKCASSI MDDHPPPLKR  120
SVSAGAAIPV STGLYINPPT PGSPSGSDVS ESSVPLASPS HVFRPVPRTA AVLPPVETTS  180
SSNDPPTSLS LSLPGVDSSE VSNRVTEPPP PPPPQPSNTI PLLPMMAAPM PVVPQLKPPG  240
LGAFNLSAEF LAVMQDMIRK EVRSYMERQN QNPNGMCFQA ADDGFRNTSV KRIGISRVDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-4141063105C-Myb DNA-Binding Domain
1msf_C2e-4141063105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521508.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-98MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0L9UQ400.0A0A0L9UQ40_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T4T80.0A0A0S3T4T8_PHAAN; Uncharacterized protein
STRINGGLYMA01G39740.21e-174(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-89myb domain protein 73